GLP-1 - 15MG Recenzje

GLP-1 | Product Description GLP-1 | Introduction GLP-1 (research-use-only) is evaluated in bioenergetic pathway studies of glucose regulation and cellular energy balance. Investigations probe GPCR-mediated signaling, mitochondrial efficiency under metabolic stress, and redox-responsive pathways in vitro. Not intended for diagnostic or therapeutic use. Incretin signaling and cAMP/PKA pathway mapping Energy balance and mitochondrial performance models Redox and stress-adaptation dynamics At a Glance: CAS 107444-51-9 · C149H226N40O45 · ≈3297.6 g/mol · ≥99% (HPLC) · 5MG / 10MG / 15MG / 20MG / 30MG Vials GLP-1 | Molecular Identity & Composition Name GLP-1 Synonyms GLP-1(7–36)-NH2 | GLP-1 (active form) Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Molecular Formula C149H226N40O45 Molecular Weight ≈3297.6 g/mol CAS Number 107444-51-9 Appearance White to off-white lyophilized powder Solubility Soluble in sterile water or bacteriostatic water Purity ≥99% (HPLC) Storage Guidelines • Lyophilized: ≤0°F (–18°C), dry, protected from light • Reconstituted: 36–46°F (2–8°C); avoid repeat freeze–thaw • Long-Term: Keep dry and frozen until use GLP-1 | Available Sizes 5MG Vial 5MG Pure GLP-1 · Single Lyophilized Vial · ≥99% (HPLC) 10MG Vial 10MG Pure GLP-1 · Single Lyophilized Vial · ≥99% (HPLC) 15MG Vial 15MG Pure GLP-1 · Single Lyophilized Vial · ≥99% (HPLC) 20MG Vial 20MG Pure GLP-1 · Single Lyophilized Vial · ≥99% (HPLC) 30MG Vial 30MG Pure GLP-1 · Single Lyophilized Vial · ≥99% (HPLC) LuvionBio Quality Advantage Purity & Identity: ≥99% | HPLC & MS validated Endotoxin & Sterility: <0.05 EU/mg | Third-party verified Stability & Process: Controlled nucleation lyophilization | Stability-focused procedures Formulation & QA: PhD-Formulated | GMP / ISO-Aligned manufacturing Packaging: Luxe Fridge-Ready Box Category Overview | Bioenergetic Pathway Modulators Bioenergetic peptides are used in RUO studies to explore how cells generate, manage, and recover energy. These compounds interact with key metabolic pathways—especially mitochondrial ATP output and redox signaling—making them essential tools for researchers investigating energy dysfunction, oxidative stress, and cell viability under stress conditions. Exciting Areas of Study Modulation of ATP output in energy-restricted cellular environments Pre-clinical insights into mitochondrial performance Stress-induced metabolic pathway behavior in controlled assays Early-stage models of energy dysregulation across tissue types Insulin sensitivity & glucose regulation in cell-based assays GLP-1 | Research Modeling & Applications Characterize incretin signaling vs. metabolic efficiency Evaluate stress-adaptation in high/low glucose models Profile redox-sensitive nodes in energy pathways Research Use Disclaimer This product is supplied for laboratory research use only (RUO) and is intended solely for qualified professionals in a controlled research setting. It is not a drug, food, dietary supplement, cosmetic, or medical device, and is not intended for human or veterinary use or for any diagnostic, therapeutic, or clinical application. It is not for household use. No statement on this page has been evaluated by the U.S. Food and Drug Administration. Nothing herein is intended to diagnose, treat, cure, or prevent any disease, nor to suggest any dosage, route, or method of administration. LuvionBio makes no representation or warranty, express or implied, regarding fitness for any purpose other than research and provides no medical or professional advice. The purchaser and end user assume full responsibility for safe handling, storage, and use in accordance with all applicable laws, regulations, and institutional safety protocols, and accept all associated risk and liability. See our Terms & Conditions and our Research Compliance Disclaimers for complete terms.